Biochemfusion protein renderers

BSD-style licensed source code that transforms Biochemfusion protein cartridge rendering info into a graphical presentation. Latest change/upload was done on 2009-05-15.

[Image: Example protein renderings.]

Example renderings based on rendering info input below. The graphics have been produced by taking screenshots from a Delphi test application.

Rendering info for the Cyclosporin is (one line broken into several for legibility)

:BCF_SEQ_RNDR_INFO_V1:BB10,5,20,1,11:
CH1,00,1T1A1G1LV1LA2A1L1L1V:
XL11,1,11,1,5,-1,5,-1,-2,111,-2,111,5,109,5:ED

Rendering info for human insulin is (one line broken into several for legibility)

:BCF_SEQ_RNDR_INFO_V1:BB10,5,20,3,51:
CH1,00,GIVEQCCTSICSLYQLENYCN:CH2,00,FVNQHLCGSHLVEALYLVCGERGFFYTPKT:
SS6,11,55,0,55,-2,105,-2,105,0:SS7,28,65,10,65,12,75,12,75,13,75,15:
SS20,40,195,10,195,11,195,11,195,12,195,15:ED

Flash test - requires Flash Player 9 or later version

If you have a Flash Player installed you should see two protein renderings below. The renderings will scale with your browser width and display a scroll bar if the rendering becomes taller than its containing window.

Flash rendering of Cyclosporin CsA.

Flash rendering of Human Insulin.