

Biochemfusion protein renderers
BSD-style licensed source code that transforms Biochemfusion protein cartridge rendering info into a graphical presentation. Latest change/upload was done on 2009-05-15.
- Delphi version: ProteinRenderer.pas plus ProteinRendererConsts.pas
- Flash version (ActionScript 3.0):
ProteinRenderer.as plus
BCFProteinViewer.as (the main class) plus
BCFScrollBar.as (simple scrollbar class) plus
RenderTags.as (constants).
You can download the compiled version BCFProteinViewer.swf as well - you will probably need to right-click and "Save link as..." to be able to download it.
Example renderings based on rendering info input below. The graphics have been produced by taking screenshots from a Delphi test application.
Rendering info for the Cyclosporin is (one line broken into several for legibility)
:BCF_SEQ_RNDR_INFO_V1:BB10,5,20,1,11: CH1,00,1T1A1G1LV1LA2A1L1L1V: XL11,1,11,1,5,-1,5,-1,-2,111,-2,111,5,109,5:ED
Rendering info for human insulin is (one line broken into several for legibility)
:BCF_SEQ_RNDR_INFO_V1:BB10,5,20,3,51: CH1,00,GIVEQCCTSICSLYQLENYCN:CH2,00,FVNQHLCGSHLVEALYLVCGERGFFYTPKT: SS6,11,55,0,55,-2,105,-2,105,0:SS7,28,65,10,65,12,75,12,75,13,75,15: SS20,40,195,10,195,11,195,11,195,12,195,15:ED
Flash test - requires Flash Player 9 or later version
If you have a Flash Player installed you should see two protein renderings below. The renderings will scale with your browser width and display a scroll bar if the rendering becomes taller than its containing window.
Flash rendering of Cyclosporin CsA.
Flash rendering of Human Insulin.